Intranasal route comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Last reviewed on 2026-01-03. Where a claim depends on a specific study, the study is described rather than over-claimed.
Once dissolved, the peptide is markedly less stable than the dry powder. Aqueous solutions are subject to backbone hydrolysis and to microbial growth when they are handled without sterile technique. Buffered solutions near neutral pH are common for short-term laboratory work, while acidic conditions are sometimes used to improve solubility. Analytical laboratories generally prepare working solutions fresh rather than storing them, and a residual water film left in a reopened vial can seed degradation even when the container appears dry.
Reversed-phase high-performance liquid chromatography is the standard technique for estimating peptide purity. The result is a peak-area percentage, which describes how much of the detected material elutes as the main peak in one run. Mass spectrometry confirms the molecular mass and can reveal truncated, adducted, or otherwise modified species. Amino acid analysis or tandem mass spectrometry can address sequence fidelity when identity is in doubt. None of these measurements, taken alone, establishes that a sample is fit for any specific purpose.
Lyophilized selank is normally supplied as a dry powder and is considered stable for extended periods when kept cold and dry. Moisture uptake is the main practical threat, because absorbed water promotes both hydrolysis and aggregation in the solid state. Vials are usually warmed to room temperature before opening so that condensation does not form on the powder. Supplier documentation commonly specifies -20 °C for routine storage, with -80 °C used for material intended to be archived for years.
Proposed mechanisms center on modulation of the GABA system, but no single molecular target has been confirmed. Rodent studies report changes in GABA-A receptor expression and in the turnover of serotonin, dopamine, and norepinephrine in several brain regions. Increases in brain-derived neurotrophic factor and its receptor have also been described after repeated administration. These findings come largely from animal models, and the degree to which they describe human neurochemistry remains an open question. The mechanism is best characterized as multi-system and not fully resolved.
Pharmacokinetic data are limited. Like most short peptides, Selank is vulnerable to plasma and tissue peptidases, and its measured half-life in circulation is short, on a minutes scale. The Pro-Gly-Pro tail slows this degradation but does not eliminate it. Intranasal administration is the route described in most reports, with absorption through the nasal mucosa and a hypothesized path into the central nervous system that avoids the blood-brain barrier. Direct measurements of human brain exposure are unavailable, so distribution claims rest on inference from animal work.
| Property | Value | Notes |
|---|---|---|
| Typical purity specification | 95 percent or higher by RP-HPLC | Area percentage of the main peak |
| Identity confirmation | Electrospray ionization mass spectrometry | Observed mass compared with the theoretical value near 751.9 Da |
| Recommended dry storage | -20 °C, desiccated | -80 °C for multi-year archival material |
| Solution handling | Prepare fresh; avoid long storage | Sterile filtration reduces microbial load |
| Common synonyms | TKPRPGP; TP-7 | Sequence code and laboratory designation used interchangeably |
Proposed mechanisms centre on modulation of the GABAergic system, with reports of altered expression of genes related to GABA-A receptor subunits and changed monoamine turnover. Some studies describe inhibition of enkephalinase, the enzyme that degrades endogenous enkephalins, which may prolong opioid peptide signalling. Effects on brain-derived neurotrophic factor and on cytokine expression have also been reported. These findings come largely from animal models and small human studies, and the precise primary target remains unresolved.
Published clinical evidence is limited. Most controlled trials were conducted in Russia, enrolled modest numbers of participants, and appeared in Russian-language journals, which restricts independent verification. Reported outcomes include lower anxiety scores, improved attention and memory measures, and changes in fatigue ratings. Reviews written in English note methodological limitations such as small samples and inconsistent endpoints. Whether the compound produces clinically meaningful benefit relative to established anxiolytics is therefore an open question rather than an established finding.
Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro. It was designed at the Institute of Molecular Genetics of the Russian Academy of Sciences as a structural analogue of tuftsin, a naturally occurring tetrapeptide fragment of the immunoglobulin heavy chain. The added Pro-Gly-Pro tail was intended to slow enzymatic degradation and extend biological activity. In Russia it is registered as an anxiolytic nasal preparation, while regulators elsewhere have not approved it for clinical use.
Characterization of Selank in laboratory settings relies on standard peptide analytical techniques. Reverse-phase high-performance liquid chromatography separates the peptide from related impurities and degradation products, while mass spectrometry confirms molecular identity through accurate mass measurement. Amino acid analysis and peptide sequencing verify the primary structure when reference material is unavailable. Because Selank is a short chain, fragmentation-based analysis produces a diagnostic ion pattern that supports confident identification.
Peptide stability depends strongly on temperature, moisture, and pH. Lyophilized Selank is generally most stable when stored cold and dry, with freezer temperatures commonly used for long-term storage. In solution, the compound is susceptible to hydrolysis and to microbial growth if it is not handled aseptically. The C-terminal proline-rich extension appears to slow enzymatic cleavage relative to tuftsin, though quantitative degradation rates vary with the matrix and the conditions tested. Published stability data specific to Selank remain sparse.
Quality assessment of Selank samples typically combines purity determination with identity confirmation and counter-ion analysis. Purity is usually reported as a percentage by chromatographic area, with values above 95 percent often quoted for research-grade material. Water content and residual solvents are checked in lyophilized batches because they affect both stability and accurate mass determination. A reported purity figure does not by itself establish that a sample is the intended sequence, so orthogonal methods are needed to rule out sequence isomers or truncation products.
Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro, frequently abbreviated as TKPRPGP. It was designed as a structural analogue of tuftsin, a naturally occurring tetrapeptide released by enzymatic cleavage of the immunoglobulin heavy chain. The two additional proline residues at the C-terminal end extend the parent chain and change how the molecule behaves in solution. The free peptide has a calculated molecular mass of approximately 751.9 g/mol and is generally supplied as a lyophilised white to off-white powder.
Development work on the compound began in the 1980s and 1990s at the Institute of Molecular Genetics in Moscow, within the same research programme that produced the peptide Semax. Early investigators sought a tuftsin derivative with improved resistance to enzymatic breakdown and with activity in the central nervous system after peripheral administration. Most of the primary literature from this period was published in Russian, a factor that still shapes how easily the findings can be checked by outside groups.
Naming for this compound is not fully standardised in English sources. The spelling Selanc appears in some transliterations, and catalogue entries may instead list the peptide sequence itself as the identifier. Reference material sometimes groups it with other short synthetic peptides studied for behavioural effects, which can create confusion when citations are compared. Distinguishing the exact sequence from related tuftsin analogues is therefore a practical first step when reviewing any dataset or specification sheet.
Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro. Its four N-terminal residues reproduce tuftsin, a tetrapeptide fragment of the immunoglobulin heavy chain, while the C-terminal Pro-Gly-Pro extension is a synthetic addition. The peptide has a molecular mass near 752 daltons and carries a net positive charge at physiological pH because of the arginine and lysine side chains. Published indexes list it under the name Selank and the sequence abbreviation TKPRPGP. Solid-phase peptide synthesis is the standard production route for research quantities.
Development took place at the Institute of Molecular Genetics of the Russian Academy of Sciences, where a series of short peptides were designed in the 1980s and 1990s. Selank was selected from variants of tuftsin that showed resistance to plasma peptidases. Russian regulatory approval covers it as an anxiolytic agent given intranasally. Outside that market the compound is normally handled as a research chemical rather than a medicine, and no widely recognised international pharmacopoeial monograph exists. The name Selank is a coined trade designation rather than a systematic chemical name.
=== Blastocystosis === Limited evidence suggests that S. boulardii may have a beneficial role as an adjunct in the treatment of blastocystosis; however, the available data are derived from a small number of studies, and further research is needed to establish its efficacy.
== Diagnosis == Mitochondrial diseases are usually detected by analysing muscle samples, where the presence of these organelles is higher. The most common tests for the detection of these diseases are:
For services to Young People on the Isle of Man. Walter Barry Pugh, lately Senior Storekeeper, Ministry of Defence. Joyce Winifred Pullen. For services to the Save the Children Fund in Wiltshire. Parveen Qureshi, Manager, Rotherham Multi-Cultural Centre. For services to the community. David Quinney, Station Officer, Central Scotland Fire Brigade. For services to the Fire Service. Ellen Elizabeth Redman. For services to the community in Malmesbury, Wiltshire. Cyril Redpath. For services to the Army Cadet Force in Northumbria. Lydia Elizabeth Reed, Main Executive, W.J.O. Jennings Ltd. For services to Public Transport. Alan Tait Rees. For services to the community in Edinburgh. Alistair Reid, Chairman, Scottish Fisherman's Organisation. For services to the Fisheries Industry Gwyn Rhydderch, Co-ordinator, British Arts Festivals Association. For services to the Arts. Dennis Richards. For charitable services in Penzance, Cornwall. Bryan Robert Riches, Sub-Divisional Officer, Suffolk Special Constabulary. For services to the. Police. Edmund Caerwyn Roberts. For services to Agriculture in Wales. John Aubrey Roberts. For services to the Wrexham Hospital League of Friends, North Wales. Moira Mary Ann Robertson, lately Custodian, Skara Brae. Eric Robinson. For charitable services in Nantwich, Cheshire. Jeremy John Lawrence Robinson, Senior Executive Officer, Ministry of Defence. John Robinson, Managing Director, S. Robinson & Sons (Eng.) Ltd. For services to the Construction Industry. Frank Rodgers. For services to the Environment in Derbyshire. David Gordon Rollo.
Sources: en.wikipedia.org
==== Common welfare concerns ==== Welfare in aquaculture can be impacted by a number of issues such as stocking densities, behavioural interactions, disease and parasitism. A major problem in determining the cause of impaired welfare is that these issues are often all interrelated and influence each other at different times. Optimal stocking density is often defined by the carrying capacity of the stocked environment and the amount of individual space needed by the fish, which is very species specific. Although behavioural interactions such as shoaling may mean that high stocking densities are beneficial to some species, in many cultured species high stocking densities may be of concern. Crowding can constrain normal swimming behaviour, as well as increase aggressive and competitive behaviours such as cannibalism, feed competition, territoriality and dominance/subordination hierarchies. This potentially increases the risk of tissue damage due to abrasion from fish-to-fish contact or fish-to-cage contact. Fish can suffer reductions in food intake and food conversion efficiency. In addition, high stocking densities can result in water flow being insufficient, creating inadequate oxygen supply and waste product removal. Dissolved oxygen is essential for fish respiration and concentrations below critical levels can induce stress and even lead to asphyxiation. Ammonia, a nitrogen excretion product, is highly toxic to fish at accumulated levels, particularly when oxygen concentrations are low.
Two polypeptides. A large subunit of 104 amino acids (sequence TMWGTKWCGSGNEATDISELGYWSNLDSCCRTHDHCDNIPSGQTKYGLTNEGKYTMMNCKCETAFEQCLRNVTGGMEGPAAGFVRKTYFDLYGNGCYNVQCPSQ) and a smaller one of 27 amino acids (sequence SEECPDGVATYTGEAGYGAWAINKLNG). Subunits are linked by a disulfide bond. Phospholipase A2 (PLA2) activity on the large subunit. The molecular weight of the toxin is 15 kDa. Like IpTxa, IpTxi acts on RyR. When an action potential reaches the muscle, RyR channels open and Ca2+ becomes available in the cell to induce contraction. The presence of Ca2+ induces the large subunit of IpTxi to hydrolyze the Sn2 fatty acyl bond from the membrane of the sarcoplasmatic reticulum. This process is executed by PLA2 activity. The freed fatty acids bind to the RyR itself or to a closely associated protein linked to gating. Binding of the RyR induces blocking of the channel. When the concentration of free fatty acids is low there will be an incomplete block of RyR; higher concentrations will give a complete block. Because IpTxi also works on the RyR channels of the heart muscles, it could potentially be used as a drug against arrhythmia. This has not yet been proven, and must be studied in vivo first.
== Osteopathies, chondropathies, and acquired musculoskeletal deformities (730–739) == 730 Osteomyelitis, periostitis, and other infections involving bone 731 Osteitis deformans and osteopathies associated with other disorders 732 Osteochondropathies 732.7 Osteochondritis dissecans 733 Other disorders of bone and cartilage 733.0 Osteoporosis 733.1 Pathologic fracture 733.2 Cyst of bone 733.3 Hyperostosis of skull 733.4 Aseptic necrosis of bone 733.5 Osteitis condensans 733.6 Tietze's disease Costochondritis 733.7 Algoneurodystrophy 733.8 Malunion and nonunion of fracture 733.9 Other and unspecified disorders of bone and cartilage 733.90 Disorder of bone and cartilage, unspecified Osteopenia Ostealgia 733.92 Chondromalacia 734 Flat foot 735 Acquired deformities of toe 735.0 Hallux valgus 735.2 Hallux rigidus 735.4 Hammer toe, other 736 Other acquired deformities of limbs 736.1 Mallet finger 736.2 Other acquired deformities of finger 736.7 Other acquired deformities of ankle and foot 736.8 Acquired deformities of other parts of limbs 736.81 Unequal leg length (acquired) 736.89 Other acquired deformity of other parts of limb Winged scapula 736.9 Acquired deformity, limb, unspec. 737 Curvature of spine 737.1 Kyphosis (acquired) 737.2 Lordosis (acquired) 737.3 Scoliosis 737.9 Kyphosis/scoliosis, unspec.
== Mechanism == The creatine phosphate system is needed for the storage and transmission of phosphate-bound energy in the brain and muscle. The brain and muscle have particularly high metabolic demands, therefore, making creatine a necessary molecule in ATP homeostasis. In regard to the brain, in order for creatine to reach the brain, it must first pass through the blood–brain barrier (BBB). The BBB separates blood from brain interstitial fluid and is, therefore, able to regulate the transfer of nutrients to the brain from the blood. In order to pass through the BBB, creatine utilizes creatine transporter (CRT). When present at the BBB, CRT mediates the passage of creatine from the blood to the brain. When being transported from the blood to the brain, creatine has to constantly move against the creatine concentration gradient that is present at the border between the brain and circulating blood.
Sources: en.wikipedia.org
Sealed, desiccated storage at -20 °C or colder is the standard recommendation for research-grade material. Vials should reach room temperature before they are opened, which limits condensation. Repeated temperature cycling is discouraged.
A reported purity value reflects the share of the main peak in one chromatographic run and says nothing about identity. Confirming that the expected sequence is present requires a separate measurement such as mass spectrometry. Purity and identity are distinct questions.
A mass spectrum reports the molecular masses present in a sample and shows whether they match the value expected for selank, near 751.9 Da. It also flags common artifacts such as truncation or adduct formation. It does not establish correct stereochemistry or complete sequence order on its own.
Reports describe effects on GABA-A receptor expression, monoamine turnover, and neurotrophic factor levels. These are proposed mechanisms drawn mainly from animal models. No single molecular target has been established.